Lineage for d1xiya1 (1xiy A:2-180)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118053Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains)
  6. 2118054Protein 1-Cys peroxiredoxin [52909] (3 species)
  7. 2118058Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142367] (2 PDB entries)
    Uniprot Q5MYR6 60-238
  8. 2118059Domain d1xiya1: 1xiy A:2-180 [122022]

Details for d1xiya1

PDB Entry: 1xiy (more details), 1.8 Å

PDB Description: Crystal Structure of Plasmodium falciparum antioxidant protein (1-Cys peroxiredoxin)
PDB Compounds: (A:) peroxiredoxin

SCOPe Domain Sequences for d1xiya1:

Sequence, based on SEQRES records: (download)

>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kendlipnvkvmidvrnmnnisdtdgspndftsidthelfnnkkillislpgaftptcst
kmipgyeeeydyfikennfddiycitnndiyvlkswfksmdikkikyisdgnssftdsmn
mlvdksnffmgmrpwrfvaivennilvkmfqekdkqhniqtdpydistvnnvkeflknn

Sequence, based on observed residues (ATOM records): (download)

>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kendlipnvkvmidvrnmnnndftsidthelfnnkkillislpgaftptcstkmipgyee
eydyfikennfddiycitnndiyvlkswfksmdikkikyisdgnssftdsmnmlvdksnf
fmgmrpwrfvaivennilvkmfqekdkqhniqtdpydistvnnvkeflknn

SCOPe Domain Coordinates for d1xiya1:

Click to download the PDB-style file with coordinates for d1xiya1.
(The format of our PDB-style files is described here.)

Timeline for d1xiya1: