| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
| Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
| Protein Peptidyltransferase FemX [103177] (1 species) |
| Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries) |
| Domain d1xixa2: 1xix A:165-335 [122021] automatically matched to d1ne9a2 |
PDB Entry: 1xix (more details), 2 Å
SCOPe Domain Sequences for d1xixa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xixa2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
ypsktkskikrpfrdgvevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafd
adtmrifvaeregkllstgialkygrkiwymyagsmdgntyyapyavqsemiqwaldtnt
dlydlggiesestddslyvfkhvfvkdapreyigeidkvldpevyaelvkd
Timeline for d1xixa2: