Lineage for d1xixa2 (1xix A:165-335)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921726Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 1921737Protein Peptidyltransferase FemX [103177] (1 species)
  7. 1921738Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries)
  8. 1921746Domain d1xixa2: 1xix A:165-335 [122021]
    automatically matched to d1ne9a2

Details for d1xixa2

PDB Entry: 1xix (more details), 2 Å

PDB Description: Crystal Structure of Weissella viridescens FemX Form II
PDB Compounds: (A:) FemX

SCOPe Domain Sequences for d1xixa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xixa2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
ypsktkskikrpfrdgvevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafd
adtmrifvaeregkllstgialkygrkiwymyagsmdgntyyapyavqsemiqwaldtnt
dlydlggiesestddslyvfkhvfvkdapreyigeidkvldpevyaelvkd

SCOPe Domain Coordinates for d1xixa2:

Click to download the PDB-style file with coordinates for d1xixa2.
(The format of our PDB-style files is described here.)

Timeline for d1xixa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xixa1