SCOP 1.75: Domain d1xixa1: 1xix A:1-164

Lineage for d1xixa1 (1xix A:1-164)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families)

5. Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein Peptidyltransferase FemX [103177] (1 species)

7. Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries)

8. Domain d1xixa1: 1xix A:1-164 [122020]
   automatically matched to d1ne9a1

Details for d1xixa1

PDB Entry: 1xix, 2 Å

PDB Description: Crystal Structure of Weissella viridescens FemX Form II

PDB Compounds: (A:) FemX

SCOP Domain Sequences for d1xixa1:

Sequence; same for both SEQRES and ATOM records:

>d1xixa1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
pvlnlndpqaveryeefmrqspygqvtqdlgwakvknnwepvdvyleddqgaiiaamsml
lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldl

Timeline for d1xixa1:

• d1xixa1 first appeared in SCOP 1.73
  
• d1xixa1 appears in SCOPe 2.01
  
• d1xixa1 appears in the current release, SCOPe 2.08