Lineage for d1xixa1 (1xix A:1-164)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533683Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 2533694Protein Peptidyltransferase FemX [103177] (1 species)
  7. 2533695Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries)
  8. 2533702Domain d1xixa1: 1xix A:1-164 [122020]
    automatically matched to d1ne9a1

Details for d1xixa1

PDB Entry: 1xix (more details), 2 Å

PDB Description: Crystal Structure of Weissella viridescens FemX Form II
PDB Compounds: (A:) FemX

SCOPe Domain Sequences for d1xixa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xixa1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
pvlnlndpqaveryeefmrqspygqvtqdlgwakvknnwepvdvyleddqgaiiaamsml
lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldl

SCOPe Domain Coordinates for d1xixa1:

Click to download the PDB-style file with coordinates for d1xixa1.
(The format of our PDB-style files is described here.)

Timeline for d1xixa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xixa2