SCOPe 2.07: Domain d1xiva2: 1xiv A:165-329

Lineage for d1xiva2 (1xiv A:165-329)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [254909] (5 PDB entries)

8. Domain d1xiva2: 1xiv A:165-329 [122019]
   Other proteins in same PDB: d1xiva1, d1xiva3
   automated match to d1t2da2
   complexed with gol, rb2

Details for d1xiva2

PDB Entry: 1xiv, 1.7 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with 2-({4-chloro-[hydroxy(methoxy)methyl]cyclohexyl}amino)ethane-1,1,2-triol

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1xiva2:

Sequence; same for both SEQRES and ATOM records:

>d1xiva2 d.162.1.1 (A:165-329) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd
aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs
difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala

Timeline for d1xiva2:

• d1xiva2 first appeared in SCOP 1.73
  
• d1xiva2 appears in SCOPe 2.06
  
• d1xiva2 appears in the current release, SCOPe 2.08