SCOPe 2.05: Domain d1xiva1: 1xiv A:18-164

Lineage for d1xiva1 (1xiv A:18-164)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (5 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [254908] (5 PDB entries)

8. Domain d1xiva1: 1xiv A:18-164 [122018]
   Other proteins in same PDB: d1xiva2
   automated match to d1t2da1
   complexed with gol, rb2

Details for d1xiva1

PDB Entry: 1xiv, 1.7 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with 2-({4-chloro-[hydroxy(methoxy)methyl]cyclohexyl}amino)ethane-1,1,2-triol

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1xiva1:

Sequence, based on SEQRES records:

>d1xiva1 c.2.1.5 (A:18-164) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiiglg

Sequence, based on observed residues (ATOM records):

>d1xiva1 c.2.1.5 (A:18-164) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftrddllplnnkimieigghikkncpnafiivvtnpvdvm
vqllhqhsgvpknkiiglg

Timeline for d1xiva1:

• d1xiva1 first appeared in SCOP 1.73
  
• d1xiva1 appears in SCOPe 2.04
  
• d1xiva1 appears in SCOPe 2.06
  
• d1xiva1 appears in the current release, SCOPe 2.08