![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
![]() | Protein automated matches [226881] (8 species) not a true protein |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [254908] (5 PDB entries) |
![]() | Domain d1xiva1: 1xiv A:18-164 [122018] Other proteins in same PDB: d1xiva2, d1xiva3 automated match to d1t2da1 complexed with gol, rb2 |
PDB Entry: 1xiv (more details), 1.7 Å
SCOPe Domain Sequences for d1xiva1:
Sequence, based on SEQRES records: (download)
>d1xiva1 c.2.1.5 (A:18-164) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf iivvtnpvdvmvqllhqhsgvpknkiiglg
>d1xiva1 c.2.1.5 (A:18-164) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv sgsntyddlagadvvivtagftrddllplnnkimieigghikkncpnafiivvtnpvdvm vqllhqhsgvpknkiiglg
Timeline for d1xiva1: