Lineage for d1xilb2 (1xil B:84-198)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859482Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 859483Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 859484Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 859610Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)
  7. 859663Species Human (Homo sapiens) [TaxId:9606] [54724] (27 PDB entries)
  8. 859669Domain d1xilb2: 1xil B:84-198 [122017]
    Other proteins in same PDB: d1xila1, d1xilb1
    automatically matched to d1ap5a2
    complexed with mn, yof; mutant

Details for d1xilb2

PDB Entry: 1xil (more details), 1.53 Å

PDB Description: hydrogen bonding in human manganese superoxide dismutase containing 3- fluorotyrosine
PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOP Domain Sequences for d1xilb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xilb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1xilb2:

Click to download the PDB-style file with coordinates for d1xilb2.
(The format of our PDB-style files is described here.)

Timeline for d1xilb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xilb1