SCOP 1.73: Domain d1xilb2: 1xil B:84-198

Lineage for d1xilb2 (1xil B:84-198)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (23 PDB entries)

8. Domain d1xilb2: 1xil B:84-198 [122017]
   Other proteins in same PDB: d1xila1, d1xilb1
   automatically matched to d1ap5a2
   complexed with mn, yof; mutant

Details for d1xilb2

PDB Entry: 1xil, 1.53 Å

PDB Description: hydrogen bonding in human manganese superoxide dismutase containing 3- fluorotyrosine

PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOP Domain Sequences for d1xilb2:

Sequence; same for both SEQRES and ATOM records:

>d1xilb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1xilb2:

• d1xilb2 is new in SCOP 1.73
  
• d1xilb2 appears in SCOP 1.75
  
• d1xilb2 appears in the current release, SCOPe 2.08