Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [46618] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries) |
Domain d1xilb1: 1xil B:1-83 [122016] Other proteins in same PDB: d1xila2, d1xilb2 automatically matched to d1ap5a1 complexed with mn |
PDB Entry: 1xil (more details), 1.53 Å
SCOPe Domain Sequences for d1xilb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xilb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial qpalkfnggghinhsifwtnlsp
Timeline for d1xilb1: