SCOPe 2.02: Domain d1xila2: 1xil A:84-198

Lineage for d1xila2 (1xil A:84-198)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (27 PDB entries)

8. Domain d1xila2: 1xil A:84-198 [122015]
   Other proteins in same PDB: d1xila1, d1xilb1
   automatically matched to d1ap5a2
   complexed with mn

Details for d1xila2

PDB Entry: 1xil, 1.53 Å

PDB Description: hydrogen bonding in human manganese superoxide dismutase containing 3- fluorotyrosine

PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1xila2:

Sequence; same for both SEQRES and ATOM records:

>d1xila2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1xila2:

• d1xila2 first appeared in SCOP 1.73
  
• d1xila2 appears in SCOPe 2.01
  
• d1xila2 appears in SCOPe 2.03
  
• d1xila2 appears in the current release, SCOPe 2.08