Lineage for d1xila1 (1xil A:1-83)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633495Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 633496Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 633622Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 633675Species Human (Homo sapiens) [TaxId:9606] [46619] (23 PDB entries)
  8. 633680Domain d1xila1: 1xil A:1-83 [122014]
    Other proteins in same PDB: d1xila2, d1xilb2
    automatically matched to d1ap5a1
    complexed with mn, yof; mutant

Details for d1xila1

PDB Entry: 1xil (more details), 1.53 Å

PDB Description: hydrogen bonding in human manganese superoxide dismutase containing 3- fluorotyrosine
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOP Domain Sequences for d1xila1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xila1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1xila1:

Click to download the PDB-style file with coordinates for d1xila1.
(The format of our PDB-style files is described here.)

Timeline for d1xila1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xila2