| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.2: Long alpha-hairpin [46556] (19 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) ![]() |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [46618] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46619] (23 PDB entries) |
| Domain d1xila1: 1xil A:1-83 [122014] Other proteins in same PDB: d1xila2, d1xilb2 automatically matched to d1ap5a1 complexed with mn, yof; mutant |
PDB Entry: 1xil (more details), 1.53 Å
SCOP Domain Sequences for d1xila1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xila1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp
Timeline for d1xila1: