Lineage for d1xi2b1 (1xi2 B:1-230)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 826033Family c.23.5.3: Quinone reductase [52235] (3 proteins)
    binds FAD
  6. 826097Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 826098Species Human (Homo sapiens) [TaxId:9606] [52241] (13 PDB entries)
  8. 826104Domain d1xi2b1: 1xi2 B:1-230 [122013]
    automatically matched to d1qr2a_
    complexed with cb1, fad, zn

Details for d1xi2b1

PDB Entry: 1xi2 (more details), 1.5 Å

PDB Description: quinone reductase 2 in complex with cancer prodrug cb1954
PDB Compounds: (B:) nrh dehydrogenase [quinone] 2

SCOP Domain Sequences for d1xi2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xi2b1 c.23.5.3 (B:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOP Domain Coordinates for d1xi2b1:

Click to download the PDB-style file with coordinates for d1xi2b1.
(The format of our PDB-style files is described here.)

Timeline for d1xi2b1: