SCOPe 2.05: Domain d1xhnd_: 1xhn D:

Lineage for d1xhnd_ (1xhn D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein automated matches [190383] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188118] (2 PDB entries)

8. Domain d1xhnd_: 1xhn D: [122010]
   Other proteins in same PDB: d1xhna1
   automated match to d1xhna1

Details for d1xhnd_

PDB Entry: 1xhn, 1.95 Å

PDB Description: The crystal structure of Cellular Repressor of E1A-stimulated Genes (CREG)

PDB Compounds: (D:) Cellular Repressor of E1A-stimulated Genes

SCOPe Domain Sequences for d1xhnd_:

Sequence; same for both SEQRES and ATOM records:

>d1xhnd_ b.45.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gslppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfy
lsplqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdi
akhslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt

Timeline for d1xhnd_:

• d1xhnd_ first appeared in SCOP 1.73, called d1xhnd1
  
• d1xhnd_ appears in SCOPe 2.04
  
• d1xhnd_ is called d1xhnd2 in SCOPe 2.06
  
• d1xhnd_ appears in the current release, SCOPe 2.08, called d1xhnd2