![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein automated matches [190383] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188118] (2 PDB entries) |
![]() | Domain d1xhnd_: 1xhn D: [122010] Other proteins in same PDB: d1xhna1 automated match to d1xhna1 |
PDB Entry: 1xhn (more details), 1.95 Å
SCOPe Domain Sequences for d1xhnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhnd_ b.45.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gslppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfy lsplqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdi akhslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt
Timeline for d1xhnd_: