Lineage for d1xhnd1 (1xhn D:13-182)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801826Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 801827Superfamily b.45.1: FMN-binding split barrel [50475] (4 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 801828Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 801832Protein Cellular repressor of E1A-stimulated genes CREG1 [141356] (1 species)
  7. 801833Species Human (Homo sapiens) [TaxId:9606] [141357] (1 PDB entry)
    Uniprot O75629 49-218
  8. 801837Domain d1xhnd1: 1xhn D:13-182 [122010]
    automatically matched to 1XHN A:13-182

Details for d1xhnd1

PDB Entry: 1xhn (more details), 1.95 Å

PDB Description: The crystal structure of Cellular Repressor of E1A-stimulated Genes (CREG)
PDB Compounds: (D:) Cellular Repressor of E1A-stimulated Genes

SCOP Domain Sequences for d1xhnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhnd1 b.45.1.1 (D:13-182) Cellular repressor of E1A-stimulated genes CREG1 {Human (Homo sapiens) [TaxId: 9606]}
lppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyls
plqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdiak
hslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt

SCOP Domain Coordinates for d1xhnd1:

Click to download the PDB-style file with coordinates for d1xhnd1.
(The format of our PDB-style files is described here.)

Timeline for d1xhnd1: