Lineage for d1xhnd2 (1xhn D:13-182)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055234Family b.45.1.1: PNP-oxidase like [50476] (17 protein domains)
  6. 2055351Protein automated matches [190383] (6 species)
    not a true protein
  7. 2055358Species Human (Homo sapiens) [TaxId:9606] [188118] (2 PDB entries)
  8. 2055361Domain d1xhnd2: 1xhn D:13-182 [122010]
    Other proteins in same PDB: d1xhna1, d1xhna2, d1xhnb3, d1xhnc3, d1xhnd3
    automated match to d1xhna1

Details for d1xhnd2

PDB Entry: 1xhn (more details), 1.95 Å

PDB Description: The crystal structure of Cellular Repressor of E1A-stimulated Genes (CREG)
PDB Compounds: (D:) Cellular Repressor of E1A-stimulated Genes

SCOPe Domain Sequences for d1xhnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhnd2 b.45.1.1 (D:13-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyls
plqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdiak
hslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt

SCOPe Domain Coordinates for d1xhnd2:

Click to download the PDB-style file with coordinates for d1xhnd2.
(The format of our PDB-style files is described here.)

Timeline for d1xhnd2: