SCOPe 2.08: Domain d1xhnd2: 1xhn D:13-182

Lineage for d1xhnd2 (1xhn D:13-182)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein automated matches [190383] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188118] (3 PDB entries)

8. Domain d1xhnd2: 1xhn D:13-182 [122010]
   Other proteins in same PDB: d1xhna1, d1xhna2, d1xhnb3, d1xhnc3, d1xhnd3
   automated match to d1xhna1

Details for d1xhnd2

PDB Entry: 1xhn, 1.95 Å

PDB Description: The crystal structure of Cellular Repressor of E1A-stimulated Genes (CREG)

PDB Compounds: (D:) Cellular Repressor of E1A-stimulated Genes

SCOPe Domain Sequences for d1xhnd2:

Sequence; same for both SEQRES and ATOM records:

>d1xhnd2 b.45.1.1 (D:13-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyls
plqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdiak
hslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt

Timeline for d1xhnd2:

• d1xhnd2 first appeared in SCOP 1.73, called d1xhnd1
  
• d1xhnd2 appears in SCOPe 2.07