SCOPe 2.05: Domain d1xhnc_: 1xhn C:

Lineage for d1xhnc_ (1xhn C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein automated matches [190383] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188118] (2 PDB entries)

8. Domain d1xhnc_: 1xhn C: [122009]
   Other proteins in same PDB: d1xhna1
   automated match to d1xhna1

Details for d1xhnc_

PDB Entry: 1xhn, 1.95 Å

PDB Description: The crystal structure of Cellular Repressor of E1A-stimulated Genes (CREG)

PDB Compounds: (C:) Cellular Repressor of E1A-stimulated Genes

SCOPe Domain Sequences for d1xhnc_:

Sequence; same for both SEQRES and ATOM records:

>d1xhnc_ b.45.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyl
splqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdia
khslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt

Timeline for d1xhnc_:

• d1xhnc_ first appeared in SCOP 1.73, called d1xhnc1
  
• d1xhnc_ appears in SCOPe 2.04
  
• d1xhnc_ is called d1xhnc2 in SCOPe 2.06
  
• d1xhnc_ appears in the current release, SCOPe 2.08, called d1xhnc2