Lineage for d1xhnc_ (1xhn C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544950Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1544951Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1544952Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 1545067Protein automated matches [190383] (4 species)
    not a true protein
  7. 1545074Species Human (Homo sapiens) [TaxId:9606] [188118] (2 PDB entries)
  8. 1545076Domain d1xhnc_: 1xhn C: [122009]
    Other proteins in same PDB: d1xhna1
    automated match to d1xhna1

Details for d1xhnc_

PDB Entry: 1xhn (more details), 1.95 Å

PDB Description: The crystal structure of Cellular Repressor of E1A-stimulated Genes (CREG)
PDB Compounds: (C:) Cellular Repressor of E1A-stimulated Genes

SCOPe Domain Sequences for d1xhnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhnc_ b.45.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyl
splqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdia
khslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt

SCOPe Domain Coordinates for d1xhnc_:

Click to download the PDB-style file with coordinates for d1xhnc_.
(The format of our PDB-style files is described here.)

Timeline for d1xhnc_: