SCOP 1.73: Domain d1xhnc1: 1xhn C:13-182

Lineage for d1xhnc1 (1xhn C:13-182)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.45: Split barrel-like [50474] (2 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (3 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)

6. Protein Cellular repressor of E1A-stimulated genes CREG1 [141356] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141357] (1 PDB entry)

8. Domain d1xhnc1: 1xhn C:13-182 [122009]
   automatically matched to 1XHN A:13-182

Details for d1xhnc1

PDB Entry: 1xhn, 1.95 Å

PDB Description: The crystal structure of Cellular Repressor of E1A-stimulated Genes (CREG)

PDB Compounds: (C:) Cellular Repressor of E1A-stimulated Genes

SCOP Domain Sequences for d1xhnc1:

Sequence; same for both SEQRES and ATOM records:

>d1xhnc1 b.45.1.1 (C:13-182) Cellular repressor of E1A-stimulated genes CREG1 {Human (Homo sapiens) [TaxId: 9606]}
lppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyls
plqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdiak
hslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt

Timeline for d1xhnc1:

• d1xhnc1 is new in SCOP 1.73
  
• d1xhnc1 appears in SCOP 1.75
  
• d1xhnc1 appears in the current release, SCOPe 2.08, called d1xhnc2