![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein automated matches [190383] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188118] (2 PDB entries) |
![]() | Domain d1xhnb2: 1xhn B:13-182 [122008] Other proteins in same PDB: d1xhna1, d1xhna2, d1xhnb3, d1xhnc3, d1xhnd3 automated match to d1xhna1 |
PDB Entry: 1xhn (more details), 1.95 Å
SCOPe Domain Sequences for d1xhnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhnb2 b.45.1.1 (B:13-182) automated matches {Human (Homo sapiens) [TaxId: 9606]} lppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyls plqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdiak hslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt
Timeline for d1xhnb2: