Lineage for d1xhnb2 (1xhn B:13-182)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. Protein automated matches [190383] (6 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188118] (3 PDB entries)
  8. Domain d1xhnb2: 1xhn B:13-182 [122008]
    Other proteins in same PDB: d1xhna1, d1xhna2, d1xhnb3, d1xhnc3, d1xhnd3
    automated match to d1xhna1

Details for d1xhnb2

PDB Entry: 1xhn (more details), 1.95 Å

PDB Description: The crystal structure of Cellular Repressor of E1A-stimulated Genes (CREG)
PDB Compounds: (B:) Cellular Repressor of E1A-stimulated Genes

SCOPe Domain Sequences for d1xhnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhnb2 b.45.1.1 (B:13-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyls
plqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdiak
hslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt

SCOPe Domain Coordinates for d1xhnb2 are not available.

Timeline for d1xhnb2:

Domains from same chain:
(mouse over for more information)
d1xhnb3
Domains from other chains:
(mouse over for more information)
d1xhna1, d1xhna2, d1xhnc2, d1xhnc3, d1xhnd2, d1xhnd3