![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein Cellular repressor of E1A-stimulated genes CREG1 [141356] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141357] (1 PDB entry) Uniprot O75629 49-218 |
![]() | Domain d1xhna1: 1xhn A:13-182 [122007] Other proteins in same PDB: d1xhnb_, d1xhnc_, d1xhnd_ |
PDB Entry: 1xhn (more details), 1.95 Å
SCOPe Domain Sequences for d1xhna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhna1 b.45.1.1 (A:13-182) Cellular repressor of E1A-stimulated genes CREG1 {Human (Homo sapiens) [TaxId: 9606]} lppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyls plqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdiak hslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt
Timeline for d1xhna1: