SCOP 1.75: Domain d1xhfb1: 1xhf B:2-122

Lineage for d1xhfb1 (1xhf B:2-122)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein Aerobic respiration control protein ArcA, N-terminal domain [142035] (1 species)

7. Species Escherichia coli [TaxId:562] [142036] (2 PDB entries)
   Uniprot P0A9Q1 2-122

8. Domain d1xhfb1: 1xhf B:2-122 [122004]
   automatically matched to 1XHE A:2-122
   complexed with bef, bf2, bf4, mg; mutant

Details for d1xhfb1

PDB Entry: 1xhf, 2.15 Å

PDB Description: crystal structure of the bef3-activated receiver domain of redox response regulator arca

PDB Compounds: (B:) Aerobic respiration control protein arcA

SCOP Domain Sequences for d1xhfb1:

Sequence; same for both SEQRES and ATOM records:

>d1xhfb1 c.23.1.1 (B:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]}
qtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgkn
glllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsrt
m

Timeline for d1xhfb1:

• d1xhfb1 first appeared in SCOP 1.73
  
• d1xhfb1 is called d1xhfb_ in SCOPe 2.01
  
• d1xhfb1 appears in the current release, SCOPe 2.08, called d1xhfb_