SCOPe 2.05: Domain d1xhfa_: 1xhf A:

Lineage for d1xhfa_ (1xhf A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (59 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186855] (6 PDB entries)

8. Domain d1xhfa_: 1xhf A: [122003]
   automated match to d1mvoa_
   complexed with bef, bf2, bf4, mg

Details for d1xhfa_

PDB Entry: 1xhf, 2.15 Å

PDB Description: crystal structure of the bef3-activated receiver domain of redox response regulator arca

PDB Compounds: (A:) Aerobic respiration control protein arcA

SCOPe Domain Sequences for d1xhfa_:

Sequence; same for both SEQRES and ATOM records:

>d1xhfa_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
qtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgkn
glllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsrt
m

Timeline for d1xhfa_:

• d1xhfa_ first appeared in SCOP 1.73, called d1xhfa1
  
• d1xhfa_ appears in SCOPe 2.04
  
• d1xhfa_ appears in SCOPe 2.06
  
• d1xhfa_ appears in the current release, SCOPe 2.08