Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (59 species) not a true protein |
Species Escherichia coli [TaxId:562] [186855] (6 PDB entries) |
Domain d1xhfa_: 1xhf A: [122003] automated match to d1mvoa_ complexed with bef, bf2, bf4, mg |
PDB Entry: 1xhf (more details), 2.15 Å
SCOPe Domain Sequences for d1xhfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhfa_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} qtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgkn glllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsrt m
Timeline for d1xhfa_: