Lineage for d1xheb_ (1xhe B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464222Species Escherichia coli [TaxId:562] [186855] (10 PDB entries)
  8. 2464236Domain d1xheb_: 1xhe B: [122002]
    Other proteins in same PDB: d1xhea1
    automated match to d1mvoa_

Details for d1xheb_

PDB Entry: 1xhe (more details), 2.5 Å

PDB Description: crystal structure of the receiver domain of redox response regulator arca
PDB Compounds: (B:) Aerobic respiration control protein arcA

SCOPe Domain Sequences for d1xheb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xheb_ c.23.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
qtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgkn
glllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsrt
mq

SCOPe Domain Coordinates for d1xheb_:

Click to download the PDB-style file with coordinates for d1xheb_.
(The format of our PDB-style files is described here.)

Timeline for d1xheb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xhea1