SCOPe 2.08: Domain d1xheb_: 1xhe B:

Lineage for d1xheb_ (1xhe B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186855] (10 PDB entries)

8. Domain d1xheb_: 1xhe B: [122002]
   Other proteins in same PDB: d1xhea1
   automated match to d1mvoa_

Details for d1xheb_

PDB Entry: 1xhe, 2.5 Å

PDB Description: crystal structure of the receiver domain of redox response regulator arca

PDB Compounds: (B:) Aerobic respiration control protein arcA

SCOPe Domain Sequences for d1xheb_:

Sequence; same for both SEQRES and ATOM records:

>d1xheb_ c.23.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
qtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgkn
glllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsrt
mq

Timeline for d1xheb_:

• d1xheb_ first appeared in SCOP 1.73, called d1xheb1
  
• d1xheb_ appears in SCOPe 2.07