SCOPe 2.07: Domain d1xhea1: 1xhe A:2-122

Lineage for d1xhea1 (1xhe A:2-122)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Aerobic respiration control protein ArcA, N-terminal domain [142035] (1 species)

7. Species Escherichia coli [TaxId:562] [142036] (1 PDB entry)
   Uniprot P0A9Q1 2-122

8. Domain d1xhea1: 1xhe A:2-122 [122001]
   Other proteins in same PDB: d1xheb_

Details for d1xhea1

PDB Entry: 1xhe, 2.5 Å

PDB Description: crystal structure of the receiver domain of redox response regulator arca

PDB Compounds: (A:) Aerobic respiration control protein arcA

SCOPe Domain Sequences for d1xhea1:

Sequence; same for both SEQRES and ATOM records:

>d1xhea1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]}
qtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgkn
glllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsrt
m

Timeline for d1xhea1:

• d1xhea1 first appeared in SCOP 1.73
  
• d1xhea1 appears in SCOPe 2.06
  
• d1xhea1 appears in the current release, SCOPe 2.08