Lineage for d1xhea1 (1xhe A:2-122)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158037Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1158038Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1158039Protein Aerobic respiration control protein ArcA, N-terminal domain [142035] (1 species)
  7. 1158040Species Escherichia coli [TaxId:562] [142036] (1 PDB entry)
    Uniprot P0A9Q1 2-122
  8. 1158041Domain d1xhea1: 1xhe A:2-122 [122001]
    Other proteins in same PDB: d1xheb_

Details for d1xhea1

PDB Entry: 1xhe (more details), 2.5 Å

PDB Description: crystal structure of the receiver domain of redox response regulator arca
PDB Compounds: (A:) Aerobic respiration control protein arcA

SCOPe Domain Sequences for d1xhea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhea1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]}
qtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgkn
glllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsrt
m

SCOPe Domain Coordinates for d1xhea1:

Click to download the PDB-style file with coordinates for d1xhea1.
(The format of our PDB-style files is described here.)

Timeline for d1xhea1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xheb_