![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (7 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (25 proteins) |
![]() | Protein Aerobic respiration control protein ArcA, N-terminal domain [142035] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142036] (2 PDB entries) Uniprot P0A9Q1 2-122 |
![]() | Domain d1xhea1: 1xhe A:2-122 [122001] mutant |
PDB Entry: 1xhe (more details), 2.5 Å
SCOP Domain Sequences for d1xhea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhea1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} qtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgkn glllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsrt m
Timeline for d1xhea1: