Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
Protein cAMP-dependent PK, catalytic subunit [56116] (4 species) AGC group; PKA subfamily; serine/threonine kinase |
Species Cow (Bos taurus) [TaxId:9913] [56118] (31 PDB entries) |
Domain d1xhaa1: 1xha A:1-350 [122000] automatically matched to d1smha_ complexed with r68; mutant |
PDB Entry: 1xha (more details), 2.46 Å
SCOP Domain Sequences for d1xhaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhaa1 d.144.1.7 (A:1-350) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]} gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv khmetgnhyamkildkqkvvklkeiehtlnekrilqavnfpflvklefsfkdnsnlymvm eyapggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyi qvtdfglakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d1xhaa1: