![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein cAMP-dependent PK, catalytic subunit [56116] (4 species) AGC group; PKA subfamily; serine/threonine kinase |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56118] (31 PDB entries) |
![]() | Domain d1xh7a1: 1xh7 A:14-350 [121998] automatically matched to d1q8ua_ complexed with r96; mutant |
PDB Entry: 1xh7 (more details), 2.47 Å
SCOP Domain Sequences for d1xh7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xh7a1 d.144.1.7 (A:14-350) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]} svkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamki ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlr rigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkg rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d1xh7a1: