SCOP 1.75: Domain d1xh6a1: 1xh6 A:18-350

Lineage for d1xh6a1 (1xh6 A:18-350)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Cow (Bos taurus) [TaxId:9913] [56118] (32 PDB entries)
   Uniprot P00517

8. Domain d1xh6a1: 1xh6 A:18-350 [121997]
   automatically matched to d1q8ua_
   complexed with r94; mutant

Details for d1xh6a1

PDB Entry: 1xh6, 1.9 Å

PDB Description: Crystal Structures of Protein Kinase B Selective Inhibitors in Complex with Protein Kinase A and Mutants

PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOP Domain Sequences for d1xh6a1:

Sequence; same for both SEQRES and ATOM records:

>d1xh6a1 d.144.1.7 (A:18-350) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
flakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkildkq
kvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrrigr
fsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgrtwt
lcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgkvrf
pshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapfipk
fkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d1xh6a1:

• d1xh6a1 first appeared in SCOP 1.73
  
• d1xh6a1 is called d1xh6a_ in SCOPe 2.01
  
• d1xh6a1 appears in the current release, SCOPe 2.08, called d1xh6a_