Lineage for d1xh6a1 (1xh6 A:18-350)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734803Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 734806Species Cow (Bos taurus) [TaxId:9913] [56118] (31 PDB entries)
  8. 734812Domain d1xh6a1: 1xh6 A:18-350 [121997]
    automatically matched to d1q8ua_
    complexed with r94; mutant

Details for d1xh6a1

PDB Entry: 1xh6 (more details), 1.9 Å

PDB Description: Crystal Structures of Protein Kinase B Selective Inhibitors in Complex with Protein Kinase A and Mutants
PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOP Domain Sequences for d1xh6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xh6a1 d.144.1.7 (A:18-350) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
flakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkildkq
kvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrrigr
fsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgrtwt
lcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgkvrf
pshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapfipk
fkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOP Domain Coordinates for d1xh6a1:

Click to download the PDB-style file with coordinates for d1xh6a1.
(The format of our PDB-style files is described here.)

Timeline for d1xh6a1: