![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein cAMP-dependent PK, catalytic subunit [56116] (7 species) AGC group; PKA subfamily; serine/threonine kinase |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56118] (40 PDB entries) Uniprot P00517 |
![]() | Domain d1xh5a_: 1xh5 A: [121996] automated match to d1cmke_ complexed with bu3, r68; mutant |
PDB Entry: 1xh5 (more details), 2.05 Å
SCOPe Domain Sequences for d1xh5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xh5a_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]} svkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamki ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlr rigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkg rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d1xh5a_: