SCOPe 2.06: Domain d1xh2a1: 1xh2 A:409-496

Lineage for d1xh2a1 (1xh2 A:409-496)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225771] (21 PDB entries)

8. Domain d1xh2a1: 1xh2 A:409-496 [121993]
   Other proteins in same PDB: d1xh2a2
   automated match to d1jxka1
   complexed with are, ca, cl, nag

Details for d1xh2a1

PDB Entry: 1xh2, 2.2 Å

PDB Description: structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride and acarbose

PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1xh2a1:

Sequence; same for both SEQRES and ATOM records:

>d1xh2a1 b.71.1.0 (A:409-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

Timeline for d1xh2a1:

• d1xh2a1 first appeared in SCOP 1.73
  
• d1xh2a1 appears in SCOPe 2.05
  
• d1xh2a1 appears in SCOPe 2.07
  
• d1xh2a1 appears in the current release, SCOPe 2.08