SCOP 1.73: Domain d1xh2a1: 1xh2 A:404-496

Lineage for d1xh2a1 (1xh2 A:404-496)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (33 PDB entries)

8. Domain d1xh2a1: 1xh2 A:404-496 [121993]
   Other proteins in same PDB: d1xh2a2
   automatically matched to d1c8qa1
   complexed with are, ca, cl, nag; mutant

Details for d1xh2a1

PDB Entry: 1xh2, 2.2 Å

PDB Description: structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride and acarbose

PDB Compounds: (A:) alpha-amylase, pancreatic

SCOP Domain Sequences for d1xh2a1:

Sequence; same for both SEQRES and ATOM records:

>d1xh2a1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d1xh2a1:

• d1xh2a1 is new in SCOP 1.73
  
• d1xh2a1 appears in SCOP 1.75
  
• d1xh2a1 appears in the current release, SCOPe 2.08