Lineage for d1xh0a1 (1xh0 A:409-496)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420422Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2420423Protein automated matches [226835] (41 species)
    not a true protein
  7. 2420534Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries)
  8. 2420542Domain d1xh0a1: 1xh0 A:409-496 [121989]
    Other proteins in same PDB: d1xh0a2
    automated match to d1jxka1
    complexed with aao, nag

Details for d1xh0a1

PDB Entry: 1xh0 (more details), 2 Å

PDB Description: structure of the n298s variant of human pancreatic alpha-amylase complexed with acarbose
PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1xh0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xh0a1 b.71.1.0 (A:409-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d1xh0a1:

Click to download the PDB-style file with coordinates for d1xh0a1.
(The format of our PDB-style files is described here.)

Timeline for d1xh0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xh0a2