Lineage for d1xh0a1 (1xh0 A:404-496)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1135947Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1135948Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1135949Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1135978Protein Animal alpha-amylase [51024] (3 species)
  7. 1135979Species Human (Homo sapiens) [TaxId:9606] [51026] (42 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 1135998Domain d1xh0a1: 1xh0 A:404-496 [121989]
    Other proteins in same PDB: d1xh0a2
    automatically matched to d1c8qa1
    complexed with aao, nag

Details for d1xh0a1

PDB Entry: 1xh0 (more details), 2 Å

PDB Description: structure of the n298s variant of human pancreatic alpha-amylase complexed with acarbose
PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1xh0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xh0a1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d1xh0a1:

Click to download the PDB-style file with coordinates for d1xh0a1.
(The format of our PDB-style files is described here.)

Timeline for d1xh0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xh0a2