![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries) |
![]() | Domain d1xh0a1: 1xh0 A:409-496 [121989] Other proteins in same PDB: d1xh0a2 automated match to d1jxka1 complexed with aao, nag |
PDB Entry: 1xh0 (more details), 2 Å
SCOPe Domain Sequences for d1xh0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xh0a1 b.71.1.0 (A:409-496) automated matches {Human (Homo sapiens) [TaxId: 9606]} wydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiy vsddgkahfsisnsaedpfiaihaeskl
Timeline for d1xh0a1: