Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.4: Dihydroorotase [63917] (2 proteins) |
Protein Dihydroorotase [63918] (1 species) |
Species Escherichia coli [TaxId:562] [63919] (14 PDB entries) |
Domain d1xgeb_: 1xge B: [121975] automated match to d1j79a_ complexed with dor, ncd, zn |
PDB Entry: 1xge (more details), 1.9 Å
SCOPe Domain Sequences for d1xgeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgeb_ c.1.9.4 (B:) Dihydroorotase {Escherichia coli [TaxId: 562]} sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk
Timeline for d1xgeb_: