Lineage for d1xgea1 (1xge A:4-346)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 971773Family c.1.9.4: Dihydroorotase [63917] (2 proteins)
  6. 971774Protein Dihydroorotase [63918] (1 species)
  7. 971775Species Escherichia coli [TaxId:562] [63919] (14 PDB entries)
  8. 971794Domain d1xgea1: 1xge A:4-346 [121974]
    complexed with dor, ncd, zn

Details for d1xgea1

PDB Entry: 1xge (more details), 1.9 Å

PDB Description: dihydroorotase from escherichia coli: loop movement and cooperativity between subunits
PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d1xgea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgea1 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli [TaxId: 562]}
sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim
pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda
adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn
rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy
glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk

SCOPe Domain Coordinates for d1xgea1:

Click to download the PDB-style file with coordinates for d1xgea1.
(The format of our PDB-style files is described here.)

Timeline for d1xgea1: