Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.4: Dihydroorotase [63917] (2 proteins) |
Protein Dihydroorotase [63918] (1 species) |
Species Escherichia coli [TaxId:562] [63919] (14 PDB entries) |
Domain d1xgea1: 1xge A:4-346 [121974] complexed with dor, ncd, zn |
PDB Entry: 1xge (more details), 1.9 Å
SCOPe Domain Sequences for d1xgea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgea1 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli [TaxId: 562]} sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk
Timeline for d1xgea1: