Lineage for d1xfzr1 (1xfz R:3-75)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1489910Protein Calmodulin [47516] (12 species)
  7. 1489995Species Human (Homo sapiens) [TaxId:9606] [47517] (80 PDB entries)
    Uniprot P02593
  8. 1490099Domain d1xfzr1: 1xfz R:3-75 [121970]
    automatically matched to d1ak8__
    complexed with ca, mg

Details for d1xfzr1

PDB Entry: 1xfz (more details), 3.25 Å

PDB Description: crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 1 millimolar exogenously added calcium chloride
PDB Compounds: (R:) Calmodulin 2

SCOPe Domain Sequences for d1xfzr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfzr1 a.39.1.5 (R:3-75) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmark

SCOPe Domain Coordinates for d1xfzr1:

Click to download the PDB-style file with coordinates for d1xfzr1.
(The format of our PDB-style files is described here.)

Timeline for d1xfzr1: