Lineage for d1xfyt1 (1xfy T:3-75)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. Protein Calmodulin [47516] (13 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries)
    Uniprot P02593
  8. Domain d1xfyt1: 1xfy T:3-75 [121966]
    automatically matched to d1ak8__
    complexed with ca, mg

Details for d1xfyt1

PDB Entry: 1xfy (more details), 3.3 Å

PDB Description: crystal structure of anthrax edema factor (ef) in complex with calmodulin
PDB Compounds: (T:) Calmodulin 2

SCOPe Domain Sequences for d1xfyt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfyt1 a.39.1.5 (T:3-75) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmark

SCOPe Domain Coordinates for d1xfyt1 are not available.

Timeline for d1xfyt1:

Domains from other chains:
(mouse over for more information)
d1xfyo1, d1xfyp1, d1xfyq1, d1xfyr1, d1xfys1