Lineage for d1xfyo1 (1xfy O:3-75)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914403Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 914454Protein Calmodulin [47516] (11 species)
  7. 914533Species Cow (Bos taurus) [TaxId:9913] [47518] (26 PDB entries)
    Uniprot P62157
  8. 914563Domain d1xfyo1: 1xfy O:3-75 [121961]
    automatically matched to d1ak8__
    complexed with ca, mg

Details for d1xfyo1

PDB Entry: 1xfy (more details), 3.3 Å

PDB Description: crystal structure of anthrax edema factor (ef) in complex with calmodulin
PDB Compounds: (O:) Calmodulin 2

SCOPe Domain Sequences for d1xfyo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfyo1 a.39.1.5 (O:3-75) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmark

SCOPe Domain Coordinates for d1xfyo1:

Click to download the PDB-style file with coordinates for d1xfyo1.
(The format of our PDB-style files is described here.)

Timeline for d1xfyo1: