![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calmodulin [47516] (14 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47517] (106 PDB entries) Uniprot P02593 |
![]() | Domain d1xfvt1: 1xfv T:3-75 [121948] automatically matched to d1ak8__ complexed with 3at, ca, mg |
PDB Entry: 1xfv (more details), 3.35 Å
SCOPe Domain Sequences for d1xfvt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfvt1 a.39.1.5 (T:3-75) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt idfpefltmmark
Timeline for d1xfvt1: