SCOPe 2.03: Domain d1xfta1: 1xft A:1-128

Lineage for d1xfta1 (1xft A:1-128)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)

8. Domain d1xfta1: 1xft A:1-128 [121936]
   automatically matched to d135l__

Details for d1xfta1

PDB Entry: 1xft

PDB Description: synchrotron x-ray powder diffraction study of hexagonal turkey egg- white lysozyme

PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d1xfta1:

Sequence; same for both SEQRES and ATOM records:

>d1xfta1 d.2.1.2 (A:1-128) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcr

Timeline for d1xfta1:

• d1xfta1 first appeared in SCOP 1.73
  
• d1xfta1 appears in SCOPe 2.02
  
• d1xfta1 appears in SCOPe 2.04
  
• d1xfta1 appears in the current release, SCOPe 2.08