Lineage for d1xfqa_ (1xfq A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210736Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2210737Family d.110.3.1: PYP-like [55786] (3 proteins)
  6. 2210815Protein automated matches [254452] (1 species)
    not a true protein
  7. 2210816Species Halorhodospira halophila [TaxId:1053] [254966] (2 PDB entries)
  8. 2210818Domain d1xfqa_: 1xfq A: [121935]
    automated match to d1otda_
    complexed with hc4

Details for d1xfqa_

PDB Entry: 1xfq (more details)

PDB Description: structure of the blue shifted intermediate state of the photoactive yellow protein lacking the N-terminal part
PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d1xfqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfqa_ d.110.3.1 (A:) automated matches {Halorhodospira halophila [TaxId: 1053]}
lafgaiqldgdgnilqynaaegditgrdpkqvigknffkdvapctdspefygkfkegvas
gnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvkrv

SCOPe Domain Coordinates for d1xfqa_:

Click to download the PDB-style file with coordinates for d1xfqa_.
(The format of our PDB-style files is described here.)

Timeline for d1xfqa_: