![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.1: PYP-like [55786] (3 proteins) |
![]() | Protein automated matches [254452] (1 species) not a true protein |
![]() | Species Halorhodospira halophila [TaxId:1053] [254966] (2 PDB entries) |
![]() | Domain d1xfqa_: 1xfq A: [121935] automated match to d1otda_ complexed with hc4 |
PDB Entry: 1xfq (more details)
SCOPe Domain Sequences for d1xfqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfqa_ d.110.3.1 (A:) automated matches {Halorhodospira halophila [TaxId: 1053]} lafgaiqldgdgnilqynaaegditgrdpkqvigknffkdvapctdspefygkfkegvas gnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvkrv
Timeline for d1xfqa_: